PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010938938.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family TALE
Protein Properties Length: 747aa    MW: 81287.6 Da    PI: 7.8159
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010938938.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82e-095385751954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  XP_010938938.1 538 FEHflHPYPSDADKHLLARQTGLSRSQVSNWFINARVR 575
                     664459******************************88 PP

2BELL121.92.7e-39399469272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     r e+q+kkakL+s+l+eVd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  XP_010938938.1 399 RFEHQRKKAKLISMLDEVDRRYNHYCDQMQMVVNCFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 469
                     779*****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.8E-69322467IPR006563POX domain
PfamPF075268.5E-51327466IPR006563POX domain
PROSITE profilePS5007112.568516579IPR001356Homeobox domain
CDDcd000862.00E-13519580No hitNo description
SMARTSM003895.8E-10519583IPR001356Homeobox domain
SuperFamilySSF466892.35E-17521586IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-29522585IPR009057Homeodomain-like
PfamPF059202.6E-18536575IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
MGIATPPSPQ PARPYLSPPK PVSRPPYRPN LPTSMSQGYH HGVFSFSYGF DRSASQEQQD  60
PIAQQSRRDK LRVQGLDPGG HPLVPTEEEG EDSGIYESAT TTAATAQANN MLSEIFSFPT  120
MPATPTSDLL SSQISTSYRQ PQRLGMMAGF SGDWYSANRQ GVVLGGTNLS SFGDSTEKHH  180
HGGSQQHHPM FGLNADSTAA MQLFLMNSTL PPLLQQHHHQ RSPSPSPPAP PPTLRRHHHQ  240
AFQSFGDASF SGGVVESQGL SLSLSSSLQQ FEMPKVEELR VQDGVLYNFN NQAQQQQDHH  300
HLSLHLQGHG HGQPVRMGYG TTAVVNVLRN SKYARAVREL LEEFCSVVRG QLKGSRIGMN  360
RGSSSNPNPS HGVGGGASSS VAGASSSSKD LPPLCPADRF EHQRKKAKLI SMLDEVDRRY  420
NHYCDQMQMV VNCFDSVMGF GAATPYTALA QKAMSRHFRC LKDAIAAQLK QTCELLGEKE  480
AGSSSGLTKA ETPRLRLVDP SLRQQKAFQQ MGMMEQEAWR PQRGLPERSV NILRAWLFEH  540
FLHPYPSDAD KHLLARQTGL SRSQVSNWFI NARVRLWKPM VEEMYQQEAK EEVGERERNE  600
ASHHQGALSP TLQQPQGQRL GTGAPSESDP YPAAPPASQH HHHLFATSSS NENPPPAVAH  660
SSNGGAGGGD DTLLVRIVAP EFCGSDVQVG PTDDMYRNGT SSAATLGPAA PMRFGTAGDV  720
SLTLGLRHVG GNASEKGRFS AKDFGGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A1e-16525583563Homeobox protein Meis2
4xrm_B1e-16525583563Homeobox protein Meis2
4xrs_A1e-16525582158Homeobox protein Meis1
4xrs_B1e-16525582158Homeobox protein Meis1
5bng_A1e-16525583159Homeobox protein Meis2
5bng_B1e-16525583159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010938938.10.0PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-138BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLM0TL800.0M0TL80_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P27440_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-132BEL1-like homeodomain 4